Current repository readingScanned Jul 24, 2026, 4:52 PM UTC

MedTrack_Application Codebase Valuation

MedTrack is a full-stack medical equipment management system built with React and Spring Boot. It streamlines inventory, maintenance, and equipment orders through secure role-based access.

View kRamu81/MedTrack_Application on GitHub
Open share card
CodeValuation.com
RepoWorth
github.com/kRamu81

MedTrack_Application

MedTrack is a full-stack medical equipment management system built with React and Spring Boot. It streamlines inventory, maintenance, and equipment orders through secure role-based access.

RepoWorth$6,856Current measured development value · 4.0 active build days
Rebuild complexity90.156/100Profile: Complex
510.5K code tokens369 source filesJavaScript primary language
Scanned Jul 24, 2026Public GitHub repositorycodevaluation.com/repoworth/medtrack-application
Authored code510.5K tokens · 51,258 source lines
Complexity90.156/100 · Complex
Primary stackJavaScript
Scan coverage100% · Content scan
RepoWorth development valuation

One valuation, with the evidence behind it.

RepoWorth models the current development value represented by the visible repository evidence. It does not include ideation, intellectual property, business value, product discovery, or sale price.

RepoWorthCurrent measured development value
$6,856

Modeled range $5,485 to $8,227

4.0 active build days32.3 engineering hours403.6K implementation tokens
Repository evidenceMeasured at the scanned commit
510.5K tokens

51,258 source lines across 369 authored files

49 test files224 dependencies100% scan coverage
Measured RepoWorth history

The current RepoWorth starts the measured history.

This current scan is the first measured point. Later scans add comparable history when the repository changes. RepoWorth is not back-cast onto commits that were never scanned.

Recorded RepoWorth$6,856
Current measured reading
Measured · Jul 24, 2026Data through · Jul 24, 2026
Measurement basisCurrent readingCurrent published repository scan
Evidence coverage100%current scan
Complexity90/100Measured from code scale and structural signals
Maintainability63/100Current structure, tests, and generated-code balance

This current scan establishes the RepoWorth baseline. Comparable value changes appear only after another completed scan under the same measurement basis.

RepoWorth history compares completed repository scans only when their measurement basis is compatible. Commit activity is shown separately so delivery volume is not presented as code value.

Repository contributors

Top contributors.

Ranked from the public GitHub contributor evidence available at the latest scan. This table describes measured repository activity, not ownership or original authorship.

RankContributorContributionsShare of top groupLatest measured activity
#1kRamu81@kRamu8122153.3%Current GitHub contributor snapshot
#2dipanshubatra@dipanshubatra10725.8%Current GitHub contributor snapshot
#3AkshitRaiKakkar@AkshitRaiKakkar204.8%Current GitHub contributor snapshot
#4Anubhutisharma-07@Anubhutisharma-07133.1%Current GitHub contributor snapshot
#5kramu@kramu112.7%Current GitHub contributor snapshot
#6Kumar Gautam@Gautam-Bharadwaj102.4%Current GitHub contributor snapshot
#7hemanth562ksrm@hemanth562ksrm92.2%Current GitHub contributor snapshot
#8karan-chaos@karan-chaos92.2%Current GitHub contributor snapshot
#9Jidnyasa-P@Jidnyasa-P81.9%Current GitHub contributor snapshot
#10prathap576@prathap57671.7%Current GitHub contributor snapshot
About MedTrack_Application

What the public repository appears to contain.

MedTrack is a full-stack medical equipment management system built with React and Spring Boot. It streamlines inventory, maintenance, and equipment orders through secure role-based access.

agentic-aielasticsearchfastapifull-stackhospital-managementinventory-managementjavajwt-authenticationkafkalangchainmedical-systempython
License
MIT
Default branch
main
GitHub stars
4
Forks
26
Last public push
Jul 24, 2026
Repository state
Active public repository
Detected language profile2.2MB authored source
JavaScript62.41%
Java35.35%
CSS1.68%
XML0.36%
SQL0.15%
HTML0.04%
Source files369
Test files49
Manifests2
Dependencies224
Measured technical evidence

A fuller view of what the scanner found.

These values come from the same immutable repository scan as the headline RepoWorth. They stay tied to the scanned commit so the reading can be inspected against one exact source state.

Maintainability signal63/100

Established based on deterministic repository structure and complexity signals.

Production source443.6K tokens

First-party implementation tokens eligible for the modeled code-scale input.

Test evidence66.9K tokens

49 detected test files contribute separately from production code.

Configuration and infrastructure911 tokens

2 manifests and 0 workspace boundaries were detected.

Documentation18.5K tokens

12 documentation files remain visible as a distinct enablement signal.

Integration surface3,055 signals

224 dependency declarations and 709 public-interface signals were measured.

Repository structure9 levels deep

0 large files and 3,518 branch signals add structural context.

Excluded from authored evidence0 files

3 generated files were identified. Ignored and generated material does not inflate RepoWorth.

Measured repository distinctions

Repository evidence highlights.

Each highlight records a measured characteristic of the same repository scan used for this RepoWorth report.

architecture

Interface builder

At least 500 deterministic public interface signals were measured in source.

architecture

Integration surface

At least 1,000 deterministic integration signals were measured in source.

Technical effort profile

What makes this repository harder to rebuild.

Code scale, branching, dependencies, languages, structure, and visible test evidence shape the implementation and verification effort represented by this repository.

Code scaleHigh

Measured from the current source archive.

ComplexityHigh

Derived from branch density, dependencies, languages, and code scale.

VerificationModerate

Measures visible test code relative to the source corpus.

Development effort composition

Source volume alone does not explain the work.

This view separates authored evidence from the implementation, integration, verification, and engineering oversight represented by the current repository.

Reading boundary: These are modeled development inputs for the visible code. They do not include product discovery, company value, private systems, or commercial outcomes.

Weighted authored evidence403.6KProduction, tests, configuration, and documentation
Estimated implementation output403.6KImplementation, retries, integration, and verification
Engineering oversight32.3 hoursOrientation, integration, tests, and review
Active build time4.0 daysModeled effort represented by the current source state
Evidence boundary

What this valuation includes.

CodeValuation.com counted supported authored source on commit d42d6a908210b22a3c03654f9006e365727b4a58, measured deterministic repository signals, then estimated implementation, rework, testing, integration, and engineering oversight.

Included

Supported first-party source, tests, configuration, manifests, repository structure, dependency signals, and framework boundaries.

Excluded

Common generated and vendored files, build output, dependencies, lockfiles, minified assets, binaries, media, and private systems outside this repository.

Not claimed

Ideation, intellectual-property rights, security posture, production reliability, company value, sale price, revenue, user value, proprietary data, or the cost of discovering the original product.

This is a modeled current development valuation for the repository's visible code at a specific commit. It reflects code volume, implementation output, complexity, and engineering oversight. It is not a business valuation, investment appraisal, security review, or estimate of sale price, ideation, intellectual property, revenue, users, brand, proprietary data, undocumented domain knowledge, or private infrastructure.

Check another repository

Run RepoWorth on your own codebase.

Enter a public GitHub URL to create a current repository reading.

No sign-up for public repositories. Private repositories require a free trial. Evaluated in real time directly from GitHub. Code is never stored. Derived measurements and valuation history are saved.