Current repository readingScanned Jul 24, 2026, 4:05 PM UTC

Mailu Codebase Valuation

Insular email distribution - mail server as Docker images

View Mailu/Mailu on GitHub
Open share card
CodeValuation.com
RepoWorth
github.com/Mailu

Mailu

Insular email distribution - mail server as Docker images

RepoWorth$2,075Current measured development value · 1.3 active build days
Rebuild complexity78.04/100Profile: Complex
163.2K code tokens223 source filesPython primary language
Scanned Jul 24, 2026Public GitHub repositorycodevaluation.com/repoworth/mailu
Authored code163.2K tokens · 17,320 source lines
Complexity78.04/100 · Complex
Primary stackPython
Scan coverage93.56% · Content scan
RepoWorth development valuation

One valuation, with the evidence behind it.

RepoWorth models the current development value represented by the visible repository evidence. It does not include ideation, intellectual property, business value, product discovery, or sale price.

RepoWorthCurrent measured development value
$2,075

Modeled range $1,660 to $2,490

1.3 active build days10.4 engineering hours130.4K implementation tokens
Repository evidenceMeasured at the scanned commit
163.2K tokens

17,320 source lines across 223 authored files

42 test files31 dependencies93.56% scan coverage
Measured RepoWorth history

The current RepoWorth starts the measured history.

This current scan is the first measured point. Later scans add comparable history when the repository changes. RepoWorth is not back-cast onto commits that were never scanned.

Recorded RepoWorth$2,075
Current measured reading
Measured · Jul 24, 2026Data through · Jul 24, 2026
Measurement basisCurrent readingCurrent published repository scan
Evidence coverage94%current scan
Complexity78/100Measured from code scale and structural signals
Maintainability69/100Current structure, tests, and generated-code balance

This current scan establishes the RepoWorth baseline. Comparable value changes appear only after another completed scan under the same measurement basis.

RepoWorth history compares completed repository scans only when their measurement basis is compatible. Commit activity is shown separately so delivery volume is not presented as code value.

Repository contributors

Top contributors.

Ranked from the public GitHub contributor evidence available at the latest scan. This table describes measured repository activity, not ownership or original authorship.

RankContributorContributionsShare of top groupLatest measured activity
#1nextgens@nextgens1,02430.0%Current GitHub contributor snapshot
#2kaiyou@kaiyou1,01429.7%Current GitHub contributor snapshot
#3Diman0@Diman039511.6%Current GitHub contributor snapshot
#4ghostwheel42@ghostwheel423339.8%Current GitHub contributor snapshot
#5muhlemmer@muhlemmer2738.0%Current GitHub contributor snapshot
#6ionutfilip@ionutfilip1354.0%Current GitHub contributor snapshot
#7Nebukadneza@Nebukadneza862.5%Current GitHub contributor snapshot
#8hoellen@hoellen682.0%Current GitHub contributor snapshot
#9ofthesun9@ofthesun9421.2%Current GitHub contributor snapshot
#10HorayNarea@HorayNarea421.2%Current GitHub contributor snapshot
About Mailu

What the public repository appears to contain.

Insular email distribution - mail server as Docker images

dkimdmarcdockerdocker-composeemailfetchmailimapletsencryptmailmailserverpop3smtp
License
NOASSERTION
Default branch
master
GitHub stars
7,382
Forks
991
Last public push
Jul 24, 2026
Repository state
Active public repository
Detected language profile650.8KB authored source
Python77.6%
HTML14.56%
Shell5.01%
JavaScript1.27%
PHP0.95%
CSS0.35%
Lua0.25%
Source files223
Test files42
Manifests2
Dependencies31
Measured technical evidence

A fuller view of what the scanner found.

These values come from the same immutable repository scan as the headline RepoWorth. They stay tied to the scanned commit so the reading can be inspected against one exact source state.

Maintainability signal69/100

Established based on deterministic repository structure and complexity signals.

Production source137.1K tokens

First-party implementation tokens eligible for the modeled code-scale input.

Test evidence26.1K tokens

42 detected test files contribute separately from production code.

Configuration and infrastructure840 tokens

2 manifests and 0 workspace boundaries were detected.

Documentation87.2K tokens

53 documentation files remain visible as a distinct enablement signal.

Integration surface687 signals

31 dependency declarations and 0 public-interface signals were measured.

Repository structure6 levels deep

0 large files and 1,993 branch signals add structural context.

Excluded from authored evidence0 files

5 generated files were identified. Ignored and generated material does not inflate RepoWorth.

Technical effort profile

What makes this repository harder to rebuild.

Code scale, branching, dependencies, languages, structure, and visible test evidence shape the implementation and verification effort represented by this repository.

Code scaleModerate

Measured from the current source archive.

ComplexityHigh

Derived from branch density, dependencies, languages, and code scale.

VerificationModerate

Measures visible test code relative to the source corpus.

Development effort composition

Source volume alone does not explain the work.

This view separates authored evidence from the implementation, integration, verification, and engineering oversight represented by the current repository.

Reading boundary: These are modeled development inputs for the visible code. They do not include product discovery, company value, private systems, or commercial outcomes.

Weighted authored evidence130.4KProduction, tests, configuration, and documentation
Estimated implementation output130.4KImplementation, retries, integration, and verification
Engineering oversight10.4 hoursOrientation, integration, tests, and review
Active build time1.3 daysModeled effort represented by the current source state
Evidence boundary

What this valuation includes.

CodeValuation.com counted supported authored source on commit 8239daee0739292a2a8e76c4131ecb149b20fb07, measured deterministic repository signals, then estimated implementation, rework, testing, integration, and engineering oversight.

Included

Supported first-party source, tests, configuration, manifests, repository structure, dependency signals, and framework boundaries.

Excluded

Common generated and vendored files, build output, dependencies, lockfiles, minified assets, binaries, media, and private systems outside this repository.

Not claimed

Ideation, intellectual-property rights, security posture, production reliability, company value, sale price, revenue, user value, proprietary data, or the cost of discovering the original product.

This is a modeled current development valuation for the repository's visible code at a specific commit. It reflects code volume, implementation output, complexity, and engineering oversight. It is not a business valuation, investment appraisal, security review, or estimate of sale price, ideation, intellectual property, revenue, users, brand, proprietary data, undocumented domain knowledge, or private infrastructure.

Check another repository

Run RepoWorth on your own codebase.

Enter a public GitHub URL to create a current repository reading.

No sign-up for public repositories. Private repositories require a free trial. Evaluated in real time directly from GitHub. Code is never stored. Derived measurements and valuation history are saved.