Current repository readingScanned Jul 25, 2026, 9:58 AM UTC

langchain-shannonbase Codebase Valuation

LangChain VectorStore for MySQL 9's native VECTOR type — RAG on ShannonBase, self-hosted MySQL, or HeatWave. No separate vector DB needed.

View apoorva-01/langchain-shannonbase on GitHub
Open share card
CodeValuation.com
RepoWorth
github.com/apoorva-01

langchain-shannonbase

LangChain VectorStore for MySQL 9's native VECTOR type — RAG on ShannonBase, self-hosted MySQL, or HeatWave. No separate vector DB needed.

RepoWorth$224.83Current measured development value · Less than one active build day
Rebuild complexity63.215/100Profile: Complex
19.1K code tokens18 source filesPython primary language
Scanned Jul 25, 2026Public GitHub repositorycodevaluation.com/repoworth/langchain-shannonbase
Authored code19.1K tokens · 2,134 source lines
Complexity63.215/100 · Complex
Primary stackPython
Scan coverage100% · Content scan
RepoWorth development valuation

One valuation, with the evidence behind it.

RepoWorth models the current development value represented by the visible repository evidence. It does not include ideation, intellectual property, business value, product discovery, or sale price.

RepoWorthCurrent measured development value
$224.83

Modeled range $179.86 to $269.80

0.2 active build days1.2 engineering hours15.4K implementation tokens
Repository evidenceMeasured at the scanned commit
19.1K tokens

2,134 source lines across 18 authored files

8 test files35 dependencies100% scan coverage
Repository evidence

Building the historical and contribution view.

The headline RepoWorth and measured source facts are ready. Comparable history, accepted changes, and badge evidence will appear here as enrichment finishes.

Repository contributors

Top contributors.

Ranked from the public GitHub contributor evidence available at the latest scan. This table describes measured repository activity, not ownership or original authorship.

RankContributorContributionsShare of top groupLatest measured activity
#1apoorva-01@apoorva-0185100.0%Current GitHub contributor snapshot
About langchain-shannonbase

What the public repository appears to contain.

LangChain VectorStore for MySQL 9's native VECTOR type — RAG on ShannonBase, self-hosted MySQL, or HeatWave. No separate vector DB needed.

embeddingsheatwavelangchainmysqlragshannonbasevector-searchvectorstore
License
MIT
Default branch
main
GitHub stars
12
Forks
9
Last public push
Jul 18, 2026
Repository state
Active public repository
Detected language profile77.3KB authored source
Python100%
Source files18
Test files8
Manifests1
Dependencies35
Measured technical evidence

A fuller view of what the scanner found.

These values come from the same immutable repository scan as the headline RepoWorth. They stay tied to the scanned commit so the reading can be inspected against one exact source state.

Maintainability signal85/100

Strong based on deterministic repository structure and complexity signals.

Production source13.4K tokens

First-party implementation tokens eligible for the modeled code-scale input.

Test evidence5.7K tokens

8 detected test files contribute separately from production code.

Configuration and infrastructure356 tokens

1 manifests and 0 workspace boundaries were detected.

Documentation4.2K tokens

2 documentation files remain visible as a distinct enablement signal.

Integration surface136 signals

35 dependency declarations and 0 public-interface signals were measured.

Repository structure2 levels deep

0 large files and 271 branch signals add structural context.

Excluded from authored evidence0 files

0 generated files were identified. Ignored and generated material does not inflate RepoWorth.

Technical effort profile

What makes this repository harder to rebuild.

Code scale, branching, dependencies, languages, structure, and visible test evidence shape the implementation and verification effort represented by this repository.

Code scaleModerate

Measured from the current source archive.

ComplexityModerate

Derived from branch density, dependencies, languages, and code scale.

VerificationHigh

Measures visible test code relative to the source corpus.

Development effort composition

Source volume alone does not explain the work.

This view separates authored evidence from the implementation, integration, verification, and engineering oversight represented by the current repository.

Reading boundary: These are modeled development inputs for the visible code. They do not include product discovery, company value, private systems, or commercial outcomes.

Weighted authored evidence15.4KProduction, tests, configuration, and documentation
Estimated implementation output15.4KImplementation, retries, integration, and verification
Engineering oversight1.2 hoursOrientation, integration, tests, and review
Active build time0.2 daysModeled effort represented by the current source state
Evidence boundary

What this valuation includes.

CodeValuation.com counted supported authored source on commit 366606382cc7bbea272da62849b016e61035e603, measured deterministic repository signals, then estimated implementation, rework, testing, integration, and engineering oversight.

Included

Supported first-party source, tests, configuration, manifests, repository structure, dependency signals, and framework boundaries.

Excluded

Common generated and vendored files, build output, dependencies, lockfiles, minified assets, binaries, media, and private systems outside this repository.

Not claimed

Ideation, intellectual-property rights, security posture, production reliability, company value, sale price, revenue, user value, proprietary data, or the cost of discovering the original product.

This is a modeled current development valuation for the repository's visible code at a specific commit. It reflects code volume, implementation output, complexity, and engineering oversight. It is not a business valuation, investment appraisal, security review, or estimate of sale price, ideation, intellectual property, revenue, users, brand, proprietary data, undocumented domain knowledge, or private infrastructure.

Check another repository

Run RepoWorth on your own codebase.

Enter a public GitHub URL to create a current repository reading.

No sign-up for public repositories. Private repositories require a free trial. Evaluated in real time directly from GitHub. Code is never stored. Derived measurements and valuation history are saved.