Current repository readingScanned Jul 24, 2026, 9:00 AM UTC

kodbox Codebase Valuation

kodbox is a file manager for web. It is a newly designed product based on kodexplorer. It is also a web code editor, which allows you to develop websites directly within the web browser.You can run kodbox either online or locally,on Linux, Windows or Mac based platforms

View kalcaddle/kodbox on GitHub
Open share card
CodeValuation.com
RepoWorth
github.com/kalcaddle

kodbox

kodbox is a file manager for web. It is a newly designed product based on kodexplorer. It is also a web code editor, which allows you to develop websites directly within the web browser.You can run kodbox either online or locally,on Linux, Windows or Mac based platforms

RepoWorth$124,942Current measured development value · 74.9 active build days
Rebuild complexity86.727/100Profile: Complex
10.8M code tokens1.5K source filesPHP primary language
Scanned Jul 24, 2026Public GitHub repositorycodevaluation.com/repoworth/kodbox
Authored code10.8M tokens · 346,796 source lines
Complexity86.727/100 · Complex
Primary stackPHP
Scan coverage99.89% · Content scan
RepoWorth development valuation

One valuation, with the evidence behind it.

RepoWorth models the current development value represented by the visible repository evidence. It does not include ideation, intellectual property, business value, product discovery, or sale price.

RepoWorthCurrent measured development value
$124,942

Modeled range $99,953 to $149,930

74.9 active build days599.1 engineering hours7.5M implementation tokens
Repository evidenceMeasured at the scanned commit
10.8M tokens

346,796 source lines across 1,527 authored files

0 test files0 dependencies99.89% scan coverage
Measured RepoWorth history

The current RepoWorth starts the measured history.

This current scan is the first measured point. Later scans add comparable history when the repository changes. RepoWorth is not back-cast onto commits that were never scanned.

Recorded RepoWorth$124,942
Current measured reading
Measured · Jul 24, 2026Data through · Jul 24, 2026
Measurement basisCurrent readingCurrent published repository scan
Evidence coverage100%current scan
Complexity87/100Measured from code scale and structural signals
Maintainability43/100Current structure, tests, and generated-code balance

This current scan establishes the RepoWorth baseline. Comparable value changes appear only after another completed scan under the same measurement basis.

RepoWorth history compares completed repository scans only when their measurement basis is compatible. Commit activity is shown separately so delivery volume is not presented as code value.

Repository contributors

Top contributors.

Ranked from the public GitHub contributor evidence available at the latest scan. This table describes measured repository activity, not ownership or original authorship.

RankContributorContributionsShare of top groupLatest measured activity
#1kalcaddle@kalcaddle41490.4%Current GitHub contributor snapshot
#2RallyTuning@RallyTuning214.6%Current GitHub contributor snapshot
#3banias123@banias123153.3%Current GitHub contributor snapshot
#4mouism@mouism30.7%Current GitHub contributor snapshot
#5Wanfung Chu@fyzhu30.7%Current GitHub contributor snapshot
#6sinsky@sinsky10.2%Current GitHub contributor snapshot
#7Guru1-228@Guru1-22810.2%Current GitHub contributor snapshot
About kodbox

What the public repository appears to contain.

kodbox is a file manager for web. It is a newly designed product based on kodexplorer. It is also a web code editor, which allows you to develop websites directly within the web browser.You can run kodbox either online or locally,on Linux, Windows or Mac based platforms

docxfile-explorerfile-managerfile-sharingfile-uploadfile-viewerfilemanagerfilesystemfree-softwarejavascriptmarkdown-editorphp
License
Not detected
Default branch
main
GitHub stars
3,280
Forks
490
Last public push
Jul 1, 2026
Repository state
Active public repository
Detected language profile35.8MB authored source
JavaScript65.7%
PHP29.15%
CSS4.64%
HTML0.38%
SQL0.12%
Source files1,527
Test files0
Manifests19
Dependencies0
Measured technical evidence

A fuller view of what the scanner found.

These values come from the same immutable repository scan as the headline RepoWorth. They stay tied to the scanned commit so the reading can be inspected against one exact source state.

Maintainability signal43/100

Developing based on deterministic repository structure and complexity signals.

Production source10.8M tokens

First-party implementation tokens eligible for the modeled code-scale input.

Test evidence0 tokens

0 detected test files contribute separately from production code.

Configuration and infrastructure10.5K tokens

19 manifests and 0 workspace boundaries were detected.

Documentation374.8K tokens

143 documentation files remain visible as a distinct enablement signal.

Integration surface2,929 signals

0 dependency declarations and 3,154 public-interface signals were measured.

Repository structure10 levels deep

0 large files and 207,406 branch signals add structural context.

Excluded from authored evidence0 files

167 generated files were identified. Ignored and generated material does not inflate RepoWorth.

Measured repository distinctions

Repository evidence highlights.

Each highlight records a measured characteristic of the same repository scan used for this RepoWorth report.

architecture

Interface builder

At least 500 deterministic public interface signals were measured in source.

enablement

Documented foundation

At least 100,000 documentation tokens were measured in public documentation paths.

architecture

Integration surface

At least 1,000 deterministic integration signals were measured in source.

scale

System-scale codebase

More than 10 million measured source tokens in one qualifying snapshot.

complexity

Branching engine

At least 100,000 deterministic control-flow and branch signals were measured in source.

Technical effort profile

What makes this repository harder to rebuild.

Code scale, branching, dependencies, languages, structure, and visible test evidence shape the implementation and verification effort represented by this repository.

Code scaleHigh

Measured from the current source archive.

ComplexityHigh

Derived from branch density, dependencies, languages, and code scale.

VerificationLow

Measures visible test code relative to the source corpus.

Development effort composition

Source volume alone does not explain the work.

This view separates authored evidence from the implementation, integration, verification, and engineering oversight represented by the current repository.

Reading boundary: These are modeled development inputs for the visible code. They do not include product discovery, company value, private systems, or commercial outcomes.

Weighted authored evidence7.5MProduction, tests, configuration, and documentation
Estimated implementation output7.5MImplementation, retries, integration, and verification
Engineering oversight599.1 hoursOrientation, integration, tests, and review
Active build time74.9 daysModeled effort represented by the current source state
Evidence boundary

What this valuation includes.

CodeValuation.com counted supported authored source on commit a4592eff3fe5505410f6aa7a4531e34eba184f1a, measured deterministic repository signals, then estimated implementation, rework, testing, integration, and engineering oversight.

Included

Supported first-party source, tests, configuration, manifests, repository structure, dependency signals, and framework boundaries.

Excluded

Common generated and vendored files, build output, dependencies, lockfiles, minified assets, binaries, media, and private systems outside this repository.

Not claimed

Ideation, intellectual-property rights, security posture, production reliability, company value, sale price, revenue, user value, proprietary data, or the cost of discovering the original product.

This is a modeled current development valuation for the repository's visible code at a specific commit. It reflects code volume, implementation output, complexity, and engineering oversight. It is not a business valuation, investment appraisal, security review, or estimate of sale price, ideation, intellectual property, revenue, users, brand, proprietary data, undocumented domain knowledge, or private infrastructure.

Check another repository

Run RepoWorth on your own codebase.

Enter a public GitHub URL to create a current repository reading.

No sign-up for public repositories. Private repositories require a free trial. Evaluated in real time directly from GitHub. Code is never stored. Derived measurements and valuation history are saved.