Current repository readingScanned Jul 25, 2026, 9:05 AM UTC

graphql-engine Codebase Valuation

Blazing fast, instant realtime GraphQL APIs on all your data with fine grained access control, also trigger webhooks on database events.

View hasura/graphql-engine on GitHub
Open share card
CodeValuation.com
RepoWorth
github.com/hasura

graphql-engine

Blazing fast, instant realtime GraphQL APIs on all your data with fine grained access control, also trigger webhooks on database events.

RepoWorth$138,444Current measured development value · 77.5 active build days
Rebuild complexity100/100Profile: Complex
9.9M code tokens4.8K source filesTypeScript primary language
Scanned Jul 25, 2026Public GitHub repositorycodevaluation.com/repoworth/graphql-engine
Authored code9.9M tokens · 920,027 source lines
Complexity100/100 · Complex
Primary stackTypeScript
Scan coverage99.98% · Content scan
RepoWorth development valuation

One valuation, with the evidence behind it.

RepoWorth models the current development value represented by the visible repository evidence. It does not include ideation, intellectual property, business value, product discovery, or sale price.

RepoWorthCurrent measured development value
$138,444

Modeled range $110,755 to $166,132

77.5 active build days620.2 engineering hours7.8M implementation tokens
Repository evidenceMeasured at the scanned commit
9.9M tokens

920,027 source lines across 4,797 authored files

390 test files2,002 dependencies99.98% scan coverage
Repository evidence

Building the historical and contribution view.

The headline RepoWorth and measured source facts are ready. Comparable history, accepted changes, and badge evidence will appear here as enrichment finishes.

Repository contributors

Top contributors.

Ranked from the public GitHub contributor evidence available at the latest scan. This table describes measured repository activity, not ownership or original authorship.

RankContributorContributionsShare of top groupLatest measured activity
#1Federico Rao@Federicorao1100.0%Current GitHub contributor snapshot
About graphql-engine

What the public repository appears to contain.

Blazing fast, instant realtime GraphQL APIs on all your data with fine grained access control, also trigger webhooks on database events.

access-controlapiautomatic-apibigquerygraphqlgraphql-apigraphql-serverhaskellhasuramongodbpostgresrest-api
License
Apache-2.0
Default branch
master
GitHub stars
32,050
Forks
2,936
Last public push
Jul 25, 2026
Repository state
Active public repository
Detected language profile40MB authored source
TypeScript35.63%
SQL28.01%
JavaScript18.32%
Rust9.25%
Go3.21%
Python1.73%
C1.13%
CSS1.05%
Source files4,797
Test files390
Manifests83
Dependencies2,002
Measured technical evidence

A fuller view of what the scanner found.

These values come from the same immutable repository scan as the headline RepoWorth. They stay tied to the scanned commit so the reading can be inspected against one exact source state.

Maintainability signal58/100

Established based on deterministic repository structure and complexity signals.

Production source8.6M tokens

First-party implementation tokens eligible for the modeled code-scale input.

Test evidence1.4M tokens

390 detected test files contribute separately from production code.

Configuration and infrastructure24.2K tokens

83 manifests and 0 workspace boundaries were detected.

Documentation1.6M tokens

999 documentation files remain visible as a distinct enablement signal.

Integration surface38,515 signals

2,002 dependency declarations and 15,626 public-interface signals were measured.

Repository structure15 levels deep

0 large files and 117,868 branch signals add structural context.

Excluded from authored evidence0 files

120 generated files were identified. Ignored and generated material does not inflate RepoWorth.

Measured repository distinctions

Repository evidence highlights.

Each highlight records a measured characteristic of the same repository scan used for this RepoWorth report.

complexity

Branching engine

At least 100,000 deterministic control-flow and branch signals were measured in source.

architecture

Dependency ecosystem

At least 500 dependency declarations were measured across supported manifests.

enablement

Documentation atlas

More than one million measured documentation tokens support the public codebase.

enablement

Documented foundation

At least 100,000 documentation tokens were measured in public documentation paths.

operations

Infrastructure backbone

At least 100,000 measured tokens are in explicit infrastructure and deployment paths.

architecture

Integration mesh

At least 10,000 deterministic integration signals were measured in source.

architecture

Integration surface

At least 1,000 deterministic integration signals were measured in source.

architecture

Interface city

At least 10,000 deterministic public-interface signals were measured in source.

breadth

Polyglot system

At least five languages each represent one percent or more of measured source tokens.

architecture

Interface builder

At least 500 deterministic public interface signals were measured in source.

Technical effort profile

What makes this repository harder to rebuild.

Code scale, branching, dependencies, languages, structure, and visible test evidence shape the implementation and verification effort represented by this repository.

Code scaleHigh

Measured from the current source archive.

ComplexityHigh

Derived from branch density, dependencies, languages, and code scale.

VerificationModerate

Measures visible test code relative to the source corpus.

Development effort composition

Source volume alone does not explain the work.

This view separates authored evidence from the implementation, integration, verification, and engineering oversight represented by the current repository.

Reading boundary: These are modeled development inputs for the visible code. They do not include product discovery, company value, private systems, or commercial outcomes.

Weighted authored evidence7.8MProduction, tests, configuration, and documentation
Estimated implementation output7.8MImplementation, retries, integration, and verification
Engineering oversight620.2 hoursOrientation, integration, tests, and review
Active build time77.5 daysModeled effort represented by the current source state
Evidence boundary

What this valuation includes.

CodeValuation.com counted supported authored source on commit f824d4d19aa1e2acdf403ecdcc66e4ae1160eab2, measured deterministic repository signals, then estimated implementation, rework, testing, integration, and engineering oversight.

Included

Supported first-party source, tests, configuration, manifests, repository structure, dependency signals, and framework boundaries.

Excluded

Common generated and vendored files, build output, dependencies, lockfiles, minified assets, binaries, media, and private systems outside this repository.

Not claimed

Ideation, intellectual-property rights, security posture, production reliability, company value, sale price, revenue, user value, proprietary data, or the cost of discovering the original product.

This is a modeled current development valuation for the repository's visible code at a specific commit. It reflects code volume, implementation output, complexity, and engineering oversight. It is not a business valuation, investment appraisal, security review, or estimate of sale price, ideation, intellectual property, revenue, users, brand, proprietary data, undocumented domain knowledge, or private infrastructure.

Check another repository

Run RepoWorth on your own codebase.

Enter a public GitHub URL to create a current repository reading.

No sign-up for public repositories. Private repositories require a free trial. Evaluated in real time directly from GitHub. Code is never stored. Derived measurements and valuation history are saved.